Anti LPCAT1 pAb (ATL-HPA012501 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012501-25

Protein Description: lysophosphatidylcholine acyltransferase 1
Gene Name: LPCAT1
Alternative Gene Name: AYTL2, FLJ12443
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021608: 99%, ENSRNOG00000017930: 99%
Entrez Gene ID: 79888
Uniprot ID: Q8NF37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC
• Gene Sequence: AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC
• Gene ID - Mouse: ENSMUSG00000021608
• Gene ID - Rat: ENSRNOG00000017930
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LPCAT1 pAb (ATL-HPA012501 w/enhanced validation) – 2 Found

van Riet, Sander; Ninaber, Dennis K; Mikkers, Harald M M; Tetley, Teresa D; Jost, Carolina R; Mulder, Aat A; Pasman, Thijs; Baptista, Danielle; Poot, André A; Truckenmüller, Roman; Mummery, Christine L; Freund, Christian; Rottier, Robbert J; Hiemstra, Pieter S. In vitro modelling of alveolar repair at the air-liquid interface using alveolar epithelial cells derived from human induced pluripotent stem cells. Scientific Reports. 2020;10(1):5499. 

Lamers, Mart M; van der Vaart, Jelte; Knoops, Kèvin; Riesebosch, Samra; Breugem, Tim I; Mykytyn, Anna Z; Beumer, Joep; Schipper, Debby; Bezstarosti, Karel; Koopman, Charlotte D; Groen, Nathalie; Ravelli, Raimond B G; Duimel, Hans Q; Demmers, Jeroen A A; Verjans, Georges M G M; Koopmans, Marion P G; Muraro, Mauro J; Peters, Peter J; Clevers, Hans; Haagmans, Bart L. An organoid-derived bronchioalveolar model for SARS-CoV-2 infection of human alveolar type II-like cells. The Embo Journal. 2021;40(5):e105912.