Anti LPAR4 pAb (ATL-HPA046563)

Atlas Antibodies

Catalog No.:
ATL-HPA046563-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: lysophosphatidic acid receptor 4
Gene Name: LPAR4
Alternative Gene Name: GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049929: 96%, ENSRNOG00000002428: 96%
Entrez Gene ID: 2846
Uniprot ID: Q99677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
Gene Sequence KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
Gene ID - Mouse ENSMUSG00000049929
Gene ID - Rat ENSRNOG00000002428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LPAR4 pAb (ATL-HPA046563)
Datasheet Anti LPAR4 pAb (ATL-HPA046563) Datasheet (External Link)
Vendor Page Anti LPAR4 pAb (ATL-HPA046563) at Atlas Antibodies

Documents & Links for Anti LPAR4 pAb (ATL-HPA046563)
Datasheet Anti LPAR4 pAb (ATL-HPA046563) Datasheet (External Link)
Vendor Page Anti LPAR4 pAb (ATL-HPA046563)