Anti LPAR4 pAb (ATL-HPA046563)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046563-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LPAR4
Alternative Gene Name: GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049929: 96%, ENSRNOG00000002428: 96%
Entrez Gene ID: 2846
Uniprot ID: Q99677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM |
Gene Sequence | KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM |
Gene ID - Mouse | ENSMUSG00000049929 |
Gene ID - Rat | ENSRNOG00000002428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LPAR4 pAb (ATL-HPA046563) | |
Datasheet | Anti LPAR4 pAb (ATL-HPA046563) Datasheet (External Link) |
Vendor Page | Anti LPAR4 pAb (ATL-HPA046563) at Atlas Antibodies |
Documents & Links for Anti LPAR4 pAb (ATL-HPA046563) | |
Datasheet | Anti LPAR4 pAb (ATL-HPA046563) Datasheet (External Link) |
Vendor Page | Anti LPAR4 pAb (ATL-HPA046563) |