Anti LPA pAb (ATL-HPA060604)

Atlas Antibodies

Catalog No.:
ATL-HPA060604-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lipoprotein, Lp(a)
Gene Name: LPA
Alternative Gene Name: LP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059481: 39%, ENSRNOG00000017223: 39%
Entrez Gene ID: 4018
Uniprot ID: P08519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHG
Gene Sequence WEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHG
Gene ID - Mouse ENSMUSG00000059481
Gene ID - Rat ENSRNOG00000017223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LPA pAb (ATL-HPA060604)
Datasheet Anti LPA pAb (ATL-HPA060604) Datasheet (External Link)
Vendor Page Anti LPA pAb (ATL-HPA060604) at Atlas Antibodies

Documents & Links for Anti LPA pAb (ATL-HPA060604)
Datasheet Anti LPA pAb (ATL-HPA060604) Datasheet (External Link)
Vendor Page Anti LPA pAb (ATL-HPA060604)