Anti LOXL2 pAb (ATL-HPA056542)

Atlas Antibodies

Catalog No.:
ATL-HPA056542-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lysyl oxidase-like 2
Gene Name: LOXL2
Alternative Gene Name: WS9-14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034205: 78%, ENSRNOG00000016758: 76%
Entrez Gene ID: 4017
Uniprot ID: Q9Y4K0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLP
Gene Sequence FGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLP
Gene ID - Mouse ENSMUSG00000034205
Gene ID - Rat ENSRNOG00000016758
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LOXL2 pAb (ATL-HPA056542)
Datasheet Anti LOXL2 pAb (ATL-HPA056542) Datasheet (External Link)
Vendor Page Anti LOXL2 pAb (ATL-HPA056542) at Atlas Antibodies

Documents & Links for Anti LOXL2 pAb (ATL-HPA056542)
Datasheet Anti LOXL2 pAb (ATL-HPA056542) Datasheet (External Link)
Vendor Page Anti LOXL2 pAb (ATL-HPA056542)