Anti LOXHD1 pAb (ATL-HPA077128)

Atlas Antibodies

Catalog No.:
ATL-HPA077128-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lipoxygenase homology domains 1
Gene Name: LOXHD1
Alternative Gene Name: DFNB77, FLJ32670, LH2D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032818: 86%, ENSRNOG00000017410: 86%
Entrez Gene ID: 125336
Uniprot ID: Q8IVV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV
Gene Sequence SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV
Gene ID - Mouse ENSMUSG00000032818
Gene ID - Rat ENSRNOG00000017410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LOXHD1 pAb (ATL-HPA077128)
Datasheet Anti LOXHD1 pAb (ATL-HPA077128) Datasheet (External Link)
Vendor Page Anti LOXHD1 pAb (ATL-HPA077128) at Atlas Antibodies

Documents & Links for Anti LOXHD1 pAb (ATL-HPA077128)
Datasheet Anti LOXHD1 pAb (ATL-HPA077128) Datasheet (External Link)
Vendor Page Anti LOXHD1 pAb (ATL-HPA077128)