Anti LOXHD1 pAb (ATL-HPA077128)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077128-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: LOXHD1
Alternative Gene Name: DFNB77, FLJ32670, LH2D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032818: 86%, ENSRNOG00000017410: 86%
Entrez Gene ID: 125336
Uniprot ID: Q8IVV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV |
| Gene Sequence | SPADFWEIALSSKMADVDISTVTGPMADYVQEGPIIPYYVSVTTGKHKDAATDSRAFIFLIGEDDERSKRIWLDYPRGKRGFSRGSV |
| Gene ID - Mouse | ENSMUSG00000032818 |
| Gene ID - Rat | ENSRNOG00000017410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LOXHD1 pAb (ATL-HPA077128) | |
| Datasheet | Anti LOXHD1 pAb (ATL-HPA077128) Datasheet (External Link) |
| Vendor Page | Anti LOXHD1 pAb (ATL-HPA077128) at Atlas Antibodies |
| Documents & Links for Anti LOXHD1 pAb (ATL-HPA077128) | |
| Datasheet | Anti LOXHD1 pAb (ATL-HPA077128) Datasheet (External Link) |
| Vendor Page | Anti LOXHD1 pAb (ATL-HPA077128) |