Anti LONRF3 pAb (ATL-HPA061162)

Atlas Antibodies

Catalog No.:
ATL-HPA061162-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: LON peptidase N-terminal domain and ring finger 3
Gene Name: LONRF3
Alternative Gene Name: FLJ22612, RNF127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016239: 47%, ENSRNOG00000013092: 47%
Entrez Gene ID: 79836
Uniprot ID: Q496Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ
Gene Sequence MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQ
Gene ID - Mouse ENSMUSG00000016239
Gene ID - Rat ENSRNOG00000013092
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LONRF3 pAb (ATL-HPA061162)
Datasheet Anti LONRF3 pAb (ATL-HPA061162) Datasheet (External Link)
Vendor Page Anti LONRF3 pAb (ATL-HPA061162) at Atlas Antibodies

Documents & Links for Anti LONRF3 pAb (ATL-HPA061162)
Datasheet Anti LONRF3 pAb (ATL-HPA061162) Datasheet (External Link)
Vendor Page Anti LONRF3 pAb (ATL-HPA061162)