Anti LONRF2 pAb (ATL-HPA057366)

Atlas Antibodies

Catalog No.:
ATL-HPA057366-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LON peptidase N-terminal domain and ring finger 2
Gene Name: LONRF2
Alternative Gene Name: FLJ45273, RNF192
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048814: 56%, ENSRNOG00000023312: 82%
Entrez Gene ID: 164832
Uniprot ID: Q1L5Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
Gene Sequence LAPDDNSLLLLRAELYLTMKNYEQALQDASAACQNEPLLIKGHQVKAQALSGLGRSKEVLKEFLYC
Gene ID - Mouse ENSMUSG00000048814
Gene ID - Rat ENSRNOG00000023312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LONRF2 pAb (ATL-HPA057366)
Datasheet Anti LONRF2 pAb (ATL-HPA057366) Datasheet (External Link)
Vendor Page Anti LONRF2 pAb (ATL-HPA057366) at Atlas Antibodies

Documents & Links for Anti LONRF2 pAb (ATL-HPA057366)
Datasheet Anti LONRF2 pAb (ATL-HPA057366) Datasheet (External Link)
Vendor Page Anti LONRF2 pAb (ATL-HPA057366)