Anti LONRF1 pAb (ATL-HPA024814)

Atlas Antibodies

Catalog No.:
ATL-HPA024814-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LON peptidase N-terminal domain and ring finger 1
Gene Name: LONRF1
Alternative Gene Name: FLJ23749, RNF191
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039633: 88%, ENSRNOG00000053706: 93%
Entrez Gene ID: 91694
Uniprot ID: Q17RB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNC
Gene Sequence EQDVIVNEDGRNKLKKQGETPNEVCMFSLAYGDIPEELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNC
Gene ID - Mouse ENSMUSG00000039633
Gene ID - Rat ENSRNOG00000053706
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LONRF1 pAb (ATL-HPA024814)
Datasheet Anti LONRF1 pAb (ATL-HPA024814) Datasheet (External Link)
Vendor Page Anti LONRF1 pAb (ATL-HPA024814) at Atlas Antibodies

Documents & Links for Anti LONRF1 pAb (ATL-HPA024814)
Datasheet Anti LONRF1 pAb (ATL-HPA024814) Datasheet (External Link)
Vendor Page Anti LONRF1 pAb (ATL-HPA024814)