Anti LONP1 pAb (ATL-HPA002192 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002192-25

Protein Description: lon peptidase 1, mitochondrial
Gene Name: LONP1
Alternative Gene Name: hLON, LonHS, PIM1, PRSS15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041168: 95%, ENSRNOG00000046502: 95%
Entrez Gene ID: 9361
Uniprot ID: P36776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
• Gene Sequence: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
• Gene ID - Mouse: ENSMUSG00000041168
• Gene ID - Rat: ENSRNOG00000046502
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LONP1 pAb (ATL-HPA002192 w/enhanced validation) – 9 Found

Bahat, Assaf; Perlberg, Shira; Melamed-Book, Naomi; Lauria, Ines; Langer, Thomas; Orly, Joseph. StAR enhances transcription of genes encoding the mitochondrial proteases involved in its own degradation. Molecular Endocrinology (Baltimore, Md.). 2014;28(2):208-24. 

Richter, Uwe; Lahtinen, Taina; Marttinen, Paula; Suomi, Fumi; Battersby, Brendan J. Quality control of mitochondrial protein synthesis is required for membrane integrity and cell fitness. The Journal Of Cell Biology. 2015;211(2):373-89. 

Luo, Bin; Wang, Minggang; Hou, Nengyi; Hu, Xiao; Jia, Guiqing; Qin, Xianpeng; Zuo, Xiaofei; Liu, Yang; Luo, Kun; Song, Wei; Wang, Kang; Pang, Minghui. ATP-Dependent Lon Protease Contributes to Helicobacter pylori-Induced Gastric Carcinogenesis. Neoplasia (New York, N.y.). 2016;18(4):242-52. 

Kubota, Yoshiko; Nomura, Kazumi; Katoh, Yasutake; Yamashita, Rina; Kaneko, Kiriko; Furuyama, Kazumichi. Novel Mechanisms for Heme-dependent Degradation of ALAS1 Protein as a Component of Negative Feedback Regulation of Heme Biosynthesis. The Journal Of Biological Chemistry. 2016;291(39):20516-29. 

Quirós, Pedro M; Prado, Miguel A; Zamboni, Nicola; D'Amico, Davide; Williams, Robert W; Finley, Daniel; Gygi, Steven P; Auwerx, Johan. Multi-omics analysis identifies ATF4 as a key regulator of the mitochondrial stress response in mammals. The Journal Of Cell Biology. 2017;216(7):2027-2045. 

Sprenger, Hans-Georg; Wani, Gulzar; Hesseling, Annika; König, Tim; Patron, Maria; MacVicar, Thomas; Ahola, Sofia; Wai, Timothy; Barth, Esther; Rugarli, Elena I; Bergami, Matteo; Langer, Thomas. Loss of the mitochondrial i-AAA protease YME1L leads to ocular dysfunction and spinal axonopathy. Embo Molecular Medicine. 2019;11(1) 

Gozal, Yair M; Duong, Duc M; Gearing, Marla; Cheng, Dongmei; Hanfelt, John J; Funderburk, Christopher; Peng, Junmin; Lah, James J; Levey, Allan I. Proteomics analysis reveals novel components in the detergent-insoluble subproteome in Alzheimer's disease. Journal Of Proteome Research. 2009;8(11):5069-79. 

Gispert, Suzana; Parganlija, Dajana; Klinkenberg, Michael; Dröse, Stefan; Wittig, Ilka; Mittelbronn, Michel; Grzmil, Pawel; Koob, Sebastian; Hamann, Andrea; Walter, Michael; Büchel, Finja; Adler, Thure; Hrabé de Angelis, Martin; Busch, Dirk H; Zell, Andreas; Reichert, Andreas S; Brandt, Ulrich; Osiewacz, Heinz D; Jendrach, Marina; Auburger, Georg. Loss of mitochondrial peptidase Clpp leads to infertility, hearing loss plus growth retardation via accumulation of CLPX, mtDNA and inflammatory factors. Human Molecular Genetics. 2013;22(24):4871-87. 

Morel, Jean-David; Sleiman, Maroun Bou; Li, Terytty Yang; von Alvensleben, Giacomo; Bachmann, Alexis M; Hofer, Dina; Broeckx, Ellen; Ma, Jing Ying; Carreira, Vinicius; Chen, Tao; Azhar, Nabil; Gonzalez-Villalobos, Romer A; Breyer, Matthew; Reilly, Dermot; Mullican, Shannon; Auwerx, Johan. Mitochondrial and NAD+ metabolism predict recovery from acute kidney injury in a diverse mouse population. Jci Insight. 2023;8(3)