Anti LMX1B pAb (ATL-HPA073716)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073716-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LMX1B
Alternative Gene Name: NPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038765: 67%, ENSRNOG00000017019: 100%
Entrez Gene ID: 4010
Uniprot ID: O60663
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL |
| Gene Sequence | DIATGPESLERCFPRGQTDCAKMLDGIKMEEHALRPGPATLGVLLGSDCPHPAVCEGCQRPISDRFL |
| Gene ID - Mouse | ENSMUSG00000038765 |
| Gene ID - Rat | ENSRNOG00000017019 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LMX1B pAb (ATL-HPA073716) | |
| Datasheet | Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link) |
| Vendor Page | Anti LMX1B pAb (ATL-HPA073716) at Atlas Antibodies |
| Documents & Links for Anti LMX1B pAb (ATL-HPA073716) | |
| Datasheet | Anti LMX1B pAb (ATL-HPA073716) Datasheet (External Link) |
| Vendor Page | Anti LMX1B pAb (ATL-HPA073716) |