Anti LMOD2 pAb (ATL-HPA051039 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA051039-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leiomodin 2 (cardiac)
Gene Name: LMOD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029683: 96%, ENSRNOG00000049639: 95%
Entrez Gene ID: 442721
Uniprot ID: Q6P5Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYT
Gene Sequence RELEDIEPDRNLPVGLRQKSLTEKTPTGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYT
Gene ID - Mouse ENSMUSG00000029683
Gene ID - Rat ENSRNOG00000049639
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LMOD2 pAb (ATL-HPA051039 w/enhanced validation)
Datasheet Anti LMOD2 pAb (ATL-HPA051039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LMOD2 pAb (ATL-HPA051039 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LMOD2 pAb (ATL-HPA051039 w/enhanced validation)
Datasheet Anti LMOD2 pAb (ATL-HPA051039 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LMOD2 pAb (ATL-HPA051039 w/enhanced validation)