Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030097-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LMOD1
Alternative Gene Name: 1D, 64kD, D1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048096: 73%, ENSRNOG00000051548: 70%
Entrez Gene ID: 25802
Uniprot ID: P29536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQMPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFT |
| Gene Sequence | KRGTGNTDTKKDDEKVKKNEPLHEKEAKDDSKTKTPEKQMPSGPTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFT |
| Gene ID - Mouse | ENSMUSG00000048096 |
| Gene ID - Rat | ENSRNOG00000051548 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation) | |
| Datasheet | Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation) | |
| Datasheet | Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation) |
| Citations for Anti LMOD1 pAb (ATL-HPA030097 w/enhanced validation) – 2 Found |
| Röhl, Samuel; Suur, Bianca E; Lengquist, Mariette; Seime, Till; Caidahl, Kenneth; Hedin, Ulf; Arner, Anders; Matic, Ljubica; Razuvaev, Anton. Lack of PCSK6 Increases Flow-Mediated Outward Arterial Remodeling in Mice. Cells. 2020;9(4) PubMed |
| Seime, Till; van Wanrooij, Max; Karlöf, Eva; Kronqvist, Malin; Johansson, Staffan; Matic, Ljubica; Gasser, T Christian; Hedin, Ulf. Biomechanical Assessment of Macro-Calcification in Human Carotid Atherosclerosis and Its Impact on Smooth Muscle Cell Phenotype. Cells. 2022;11(20) PubMed |