Anti LMO4 pAb (ATL-HPA045877)

Atlas Antibodies

Catalog No.:
ATL-HPA045877-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: LIM domain only 4
Gene Name: LMO4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028266: 100%, ENSRNOG00000009205: 100%
Entrez Gene ID: 8543
Uniprot ID: P61968
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLF
Gene Sequence GKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLF
Gene ID - Mouse ENSMUSG00000028266
Gene ID - Rat ENSRNOG00000009205
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LMO4 pAb (ATL-HPA045877)
Datasheet Anti LMO4 pAb (ATL-HPA045877) Datasheet (External Link)
Vendor Page Anti LMO4 pAb (ATL-HPA045877) at Atlas Antibodies

Documents & Links for Anti LMO4 pAb (ATL-HPA045877)
Datasheet Anti LMO4 pAb (ATL-HPA045877) Datasheet (External Link)
Vendor Page Anti LMO4 pAb (ATL-HPA045877)