Anti LMO2 pAb (ATL-HPA070910)

Atlas Antibodies

SKU: ATL-HPA070910-25

• 

Protein Description: LIM domain only 2
Gene Name: LMO2
Alternative Gene Name: RBTN2, RBTNL1, RHOM2, TTG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032698: 99%, ENSRNOG00000009401: 99%
Entrez Gene ID: 4005
Uniprot ID: P25791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM
• Gene Sequence: FGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM
• Gene ID - Mouse: ENSMUSG00000032698
• Gene ID - Rat: ENSRNOG00000009401
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.