Anti LMO2 pAb (ATL-HPA070910)
Atlas Antibodies
- SKU:
- ATL-HPA070910-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: LMO2
Alternative Gene Name: RBTN2, RBTNL1, RHOM2, TTG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032698: 99%, ENSRNOG00000009401: 99%
Entrez Gene ID: 4005
Uniprot ID: P25791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM |
Gene Sequence | FGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGM |
Gene ID - Mouse | ENSMUSG00000032698 |
Gene ID - Rat | ENSRNOG00000009401 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LMO2 pAb (ATL-HPA070910) | |
Datasheet | Anti LMO2 pAb (ATL-HPA070910) Datasheet (External Link) |
Vendor Page | Anti LMO2 pAb (ATL-HPA070910) at Atlas Antibodies |
Documents & Links for Anti LMO2 pAb (ATL-HPA070910) | |
Datasheet | Anti LMO2 pAb (ATL-HPA070910) Datasheet (External Link) |
Vendor Page | Anti LMO2 pAb (ATL-HPA070910) |