Anti LMO2 pAb (ATL-HPA070901)

Atlas Antibodies

SKU:
ATL-HPA070901-25
  • Immunofluorescent staining of human cell line HEL shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: LIM domain only 2
Gene Name: LMO2
Alternative Gene Name: RBTN2, RBTNL1, RHOM2, TTG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032698: 100%, ENSRNOG00000009401: 100%
Entrez Gene ID: 4005
Uniprot ID: P25791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGR
Gene Sequence PSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGR
Gene ID - Mouse ENSMUSG00000032698
Gene ID - Rat ENSRNOG00000009401
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LMO2 pAb (ATL-HPA070901)
Datasheet Anti LMO2 pAb (ATL-HPA070901) Datasheet (External Link)
Vendor Page Anti LMO2 pAb (ATL-HPA070901) at Atlas Antibodies

Documents & Links for Anti LMO2 pAb (ATL-HPA070901)
Datasheet Anti LMO2 pAb (ATL-HPA070901) Datasheet (External Link)
Vendor Page Anti LMO2 pAb (ATL-HPA070901)