Anti LMNTD2 pAb (ATL-HPA073912)

Atlas Antibodies

SKU:
ATL-HPA073912-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytoplasmic bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lamin tail domain containing 2
Gene Name: LMNTD2
Alternative Gene Name: C11orf35, MGC35138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025500: 75%, ENSRNOG00000017050: 73%
Entrez Gene ID: 256329
Uniprot ID: Q8IXW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEERLLQTTRTLQEMEAELQNLQKSCLLQLARSSWVGRMLRSQTGSVEVVTAETLMDPSDLSE
Gene Sequence LEERLLQTTRTLQEMEAELQNLQKSCLLQLARSSWVGRMLRSQTGSVEVVTAETLMDPSDLSE
Gene ID - Mouse ENSMUSG00000025500
Gene ID - Rat ENSRNOG00000017050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LMNTD2 pAb (ATL-HPA073912)
Datasheet Anti LMNTD2 pAb (ATL-HPA073912) Datasheet (External Link)
Vendor Page Anti LMNTD2 pAb (ATL-HPA073912) at Atlas Antibodies

Documents & Links for Anti LMNTD2 pAb (ATL-HPA073912)
Datasheet Anti LMNTD2 pAb (ATL-HPA073912) Datasheet (External Link)
Vendor Page Anti LMNTD2 pAb (ATL-HPA073912)