Anti LMNTD2 pAb (ATL-HPA073912)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073912-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LMNTD2
Alternative Gene Name: C11orf35, MGC35138
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025500: 75%, ENSRNOG00000017050: 73%
Entrez Gene ID: 256329
Uniprot ID: Q8IXW0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEERLLQTTRTLQEMEAELQNLQKSCLLQLARSSWVGRMLRSQTGSVEVVTAETLMDPSDLSE |
Gene Sequence | LEERLLQTTRTLQEMEAELQNLQKSCLLQLARSSWVGRMLRSQTGSVEVVTAETLMDPSDLSE |
Gene ID - Mouse | ENSMUSG00000025500 |
Gene ID - Rat | ENSRNOG00000017050 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LMNTD2 pAb (ATL-HPA073912) | |
Datasheet | Anti LMNTD2 pAb (ATL-HPA073912) Datasheet (External Link) |
Vendor Page | Anti LMNTD2 pAb (ATL-HPA073912) at Atlas Antibodies |
Documents & Links for Anti LMNTD2 pAb (ATL-HPA073912) | |
Datasheet | Anti LMNTD2 pAb (ATL-HPA073912) Datasheet (External Link) |
Vendor Page | Anti LMNTD2 pAb (ATL-HPA073912) |