Anti LMNTD1 pAb (ATL-HPA038640)

Atlas Antibodies

Catalog No.: ATL-HPA038640-25

Protein Description: lamin tail domain containing 1
Gene Name: LMNTD1
Alternative Gene Name: FLJ36004, IFLTD1, Pas1c1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054966: 40%, ENSRNOG00000015910: 39%
Entrez Gene ID: 160492
Uniprot ID: Q8N9Z9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KQDQPKKDISNYQVEQAQVLLKREKEIPPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPNRASGSKK
• Gene Sequence: KQDQPKKDISNYQVEQAQVLLKREKEIPPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPNRASGSKK
• Gene ID - Mouse: ENSMUSG00000054966
• Gene ID - Rat: ENSRNOG00000015910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.