Anti LMNB2 pAb (ATL-HPA062477)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062477-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LMNB2
Alternative Gene Name: LMN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062075: 71%, ENSRNOG00000025742: 71%
Entrez Gene ID: 84823
Uniprot ID: Q03252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE |
Gene Sequence | PSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEE |
Gene ID - Mouse | ENSMUSG00000062075 |
Gene ID - Rat | ENSRNOG00000025742 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LMNB2 pAb (ATL-HPA062477) | |
Datasheet | Anti LMNB2 pAb (ATL-HPA062477) Datasheet (External Link) |
Vendor Page | Anti LMNB2 pAb (ATL-HPA062477) at Atlas Antibodies |
Documents & Links for Anti LMNB2 pAb (ATL-HPA062477) | |
Datasheet | Anti LMNB2 pAb (ATL-HPA062477) Datasheet (External Link) |
Vendor Page | Anti LMNB2 pAb (ATL-HPA062477) |