Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA050524-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: lamin B1
Gene Name: LMNB1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024590: 100%, ENSRNOG00000013774: 100%
Entrez Gene ID: 4001
Uniprot ID: P20700
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
Gene Sequence RTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLK
Gene ID - Mouse ENSMUSG00000024590
Gene ID - Rat ENSRNOG00000013774
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation)
Datasheet Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation)
Datasheet Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation)
Citations for Anti LMNB1 pAb (ATL-HPA050524 w/enhanced validation) – 3 Found
Nordholm, Johan; Petitou, Jeanne; Östbye, Henrik; da Silva, Diogo V; Dou, Dan; Wang, Hao; Daniels, Robert. Translational regulation of viral secretory proteins by the 5' coding regions and a viral RNA-binding protein. The Journal Of Cell Biology. 2017;216(8):2283-2293.  PubMed
Wurlitzer, Marcus; Möckelmann, Nikolaus; Kriegs, Malte; Vens, Maren; Omidi, Maryam; Hoffer, Konstantin; Bargen, Clara von; Möller-Koop, Christina; Witt, Melanie; Droste, Conrad; Oetting, Agnes; Petersen, Hannes; Busch, Chia-Jung; Münscher, Adrian; Schlüter, Hartmut; Clauditz, Till Sebastian; Rieckmann, Thorsten. Mass Spectrometric Comparison of HPV-Positive and HPV-Negative Oropharyngeal Cancer. Cancers. 2020;12(6)  PubMed
Wang, Yinuo; Elsherbiny, Adel; Kessler, Linda; Cordero, Julio; Shi, Haojie; Serke, Heike; Lityagina, Olga; Trogisch, Felix A; Mohammadi, Mona Malek; El-Battrawy, Ibrahim; Backs, Johannes; Wieland, Thomas; Heineke, Joerg; Dobreva, Gergana. Lamin A/C-dependent chromatin architecture safeguards naïve pluripotency to prevent aberrant cardiovascular cell fate and function. Nature Communications. 2022;13(1):6663.  PubMed