Anti LMLN pAb (ATL-HPA028844)

Atlas Antibodies

Catalog No.: ATL-HPA028844-100

Protein Description: leishmanolysin-like (metallopeptidase M8 family)
Gene Name: LMLN
Alternative Gene Name: Gp63, Msp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022802: 95%, ENSRNOG00000001781: 89%
Entrez Gene ID: 89782
Uniprot ID: Q96KR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWDFC
• Gene Sequence: FDELSGIPAEDLPYYGGSVEIADYCPFSQEFSWHLSGEYQRSSDCRILENQPEIFKNYGAEKYGPHSVCLIQKSAFVMEKCERKLSYPDWGSGCYQVSCSPQGLKVWVQDTSYLCSRAGQVLPVSIQMNGWIHDGNLLCPSCWDFC
• Gene ID - Mouse: ENSMUSG00000022802
• Gene ID - Rat: ENSRNOG00000001781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LMLN pAb (ATL-HPA028844) – 1 Found

Xiang, Pu; Yeung, Yiu To; Wang, Jiheng; Wu, Qiong; Du, Ruijuan; Huang, Chuntian; Jia, Xuechao; Gao, Yunfeng; Zhi, Yafei; Guo, Fangqin; Wei, Huifang; Zhang, Dandan; Liu, Yuzhang; Liu, Lina; Liang, Lijie; Wang, Juan; Song, Yongping; Liu, Kangdong; Fang, Baijun. miR-17-3p promotes the proliferation of multiple myeloma cells by downregulating P21 expression through LMLN inhibition. International Journal Of Cancer. 2021;148(12):3071-3085.