Anti LMF2 pAb (ATL-HPA062626)

Atlas Antibodies

Catalog No.:
ATL-HPA062626-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: lipase maturation factor 2
Gene Name: LMF2
Alternative Gene Name: TMEM112B, TMEM153
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022614: 95%, ENSRNOG00000030633: 95%
Entrez Gene ID: 91289
Uniprot ID: Q9BU23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSYDGHHWTEIEFMY
Gene Sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGSYDGHHWTEIEFMY
Gene ID - Mouse ENSMUSG00000022614
Gene ID - Rat ENSRNOG00000030633
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LMF2 pAb (ATL-HPA062626)
Datasheet Anti LMF2 pAb (ATL-HPA062626) Datasheet (External Link)
Vendor Page Anti LMF2 pAb (ATL-HPA062626) at Atlas Antibodies

Documents & Links for Anti LMF2 pAb (ATL-HPA062626)
Datasheet Anti LMF2 pAb (ATL-HPA062626) Datasheet (External Link)
Vendor Page Anti LMF2 pAb (ATL-HPA062626)