Anti LLPH pAb (ATL-HPA058786)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058786-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: LLPH
Alternative Gene Name: C12orf31, hLLP, MGC14817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020224: 82%, ENSRNOG00000004316: 84%
Entrez Gene ID: 84298
Uniprot ID: Q9BRT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPK |
Gene Sequence | RSKWKRKMRAEKRKKNAPKEASRLKSILKLDGDVLMKDVQEIATVVVPKPK |
Gene ID - Mouse | ENSMUSG00000020224 |
Gene ID - Rat | ENSRNOG00000004316 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LLPH pAb (ATL-HPA058786) | |
Datasheet | Anti LLPH pAb (ATL-HPA058786) Datasheet (External Link) |
Vendor Page | Anti LLPH pAb (ATL-HPA058786) at Atlas Antibodies |
Documents & Links for Anti LLPH pAb (ATL-HPA058786) | |
Datasheet | Anti LLPH pAb (ATL-HPA058786) Datasheet (External Link) |
Vendor Page | Anti LLPH pAb (ATL-HPA058786) |