Anti LLGL1 pAb (ATL-HPA023569)

Atlas Antibodies

Catalog No.: ATL-HPA023569-25

Protein Description: lethal giant larvae homolog 1 (Drosophila)
Gene Name: LLGL1
Alternative Gene Name: DLG4, HUGL, HUGL-1, LLGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020536: 86%, ENSRNOG00000003948: 86%
Entrez Gene ID: 3996
Uniprot ID: Q15334
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STVVSSHSDGSYAVWSVDAGSFPTLQPTVATTPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYG
• Gene Sequence: STVVSSHSDGSYAVWSVDAGSFPTLQPTVATTPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYG
• Gene ID - Mouse: ENSMUSG00000020536
• Gene ID - Rat: ENSRNOG00000003948
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LLGL1 pAb (ATL-HPA023569) – 1 Found

Yang, Wenhui; Zhou, Chengcheng; Luo, Mei; Shi, Xuejiao; Li, Yuan; Sun, Zengmiao; Zhou, Fang; Chen, Zhaoli; He, Jie. MiR-652-3p is upregulated in non-small cell lung cancer and promotes proliferation and metastasis by directly targeting Lgl1. Oncotarget. 2016;7(13):16703-15.