Anti LITAF pAb (ATL-HPA006960)

Atlas Antibodies

Catalog No.: ATL-HPA006960-25

Protein Description: lipopolysaccharide-induced TNF factor
Gene Name: LITAF
Alternative Gene Name: FLJ38636, PIG7, SIMPLE, TP53I7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022500: 87%, ENSRNOG00000002520: 89%
Entrez Gene ID: 9516
Uniprot ID: Q99732
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC
• Gene Sequence: APPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNC
• Gene ID - Mouse: ENSMUSG00000022500
• Gene ID - Rat: ENSRNOG00000002520
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LITAF pAb (ATL-HPA006960) – 2 Found

Zhu, Hong; Guariglia, Sara; Yu, Raymond Y L; Li, Wenjing; Brancho, Deborah; Peinado, Hector; Lyden, David; Salzer, James; Bennett, Craig; Chow, Chi-Wing. Mutation of SIMPLE in Charcot-Marie-Tooth 1C alters production of exosomes. Molecular Biology Of The Cell. 2013;24(11):1619-37, S1-3. 

Li, Wenjing; Zhu, Hong; Zhao, Xuelian; Brancho, Deborah; Liang, Yuanxin; Zou, Yiyu; Bennett, Craig; Chow, Chi-Wing. Dysregulated Inflammatory Signaling upon Charcot-Marie-Tooth Type 1C Mutation of SIMPLE Protein. Molecular And Cellular Biology. 2015;35(14):2464-78.