Anti LIPJ pAb (ATL-HPA048594)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048594-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LIPJ
Alternative Gene Name: bA425M17.2, LIPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056078: 44%, ENSRNOG00000049161: 47%
Entrez Gene ID: 142910
Uniprot ID: Q5W064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQD |
Gene Sequence | YNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHIYYKTISYYNHIDSLFGLDVYDQVYHEIIDIIQD |
Gene ID - Mouse | ENSMUSG00000056078 |
Gene ID - Rat | ENSRNOG00000049161 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LIPJ pAb (ATL-HPA048594) | |
Datasheet | Anti LIPJ pAb (ATL-HPA048594) Datasheet (External Link) |
Vendor Page | Anti LIPJ pAb (ATL-HPA048594) at Atlas Antibodies |
Documents & Links for Anti LIPJ pAb (ATL-HPA048594) | |
Datasheet | Anti LIPJ pAb (ATL-HPA048594) Datasheet (External Link) |
Vendor Page | Anti LIPJ pAb (ATL-HPA048594) |