Anti LIPH pAb (ATL-HPA049079)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049079-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LIPH
Alternative Gene Name: LPDLR, mPA-PLA1, mPA-PLA1alpha, PLA1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044626: 73%, ENSRNOG00000033441: 49%
Entrez Gene ID: 200879
Uniprot ID: Q8WWY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHL |
Gene Sequence | GCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHL |
Gene ID - Mouse | ENSMUSG00000044626 |
Gene ID - Rat | ENSRNOG00000033441 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LIPH pAb (ATL-HPA049079) | |
Datasheet | Anti LIPH pAb (ATL-HPA049079) Datasheet (External Link) |
Vendor Page | Anti LIPH pAb (ATL-HPA049079) at Atlas Antibodies |
Documents & Links for Anti LIPH pAb (ATL-HPA049079) | |
Datasheet | Anti LIPH pAb (ATL-HPA049079) Datasheet (External Link) |
Vendor Page | Anti LIPH pAb (ATL-HPA049079) |