Anti LINS1 pAb (ATL-HPA038578)

Atlas Antibodies

Catalog No.:
ATL-HPA038578-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: lines homolog 1
Gene Name: LINS1
Alternative Gene Name: LINS, WINS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053091: 28%, ENSRNOG00000042776: 25%
Entrez Gene ID: 55180
Uniprot ID: Q8NG48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TESKYDISICGCVPSLVQDQSSNQTIPHRLTAPHSHRDVCARHSWASDAPSEPLKAVMSKGAHTMCASSLSS
Gene Sequence TESKYDISICGCVPSLVQDQSSNQTIPHRLTAPHSHRDVCARHSWASDAPSEPLKAVMSKGAHTMCASSLSS
Gene ID - Mouse ENSMUSG00000053091
Gene ID - Rat ENSRNOG00000042776
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LINS1 pAb (ATL-HPA038578)
Datasheet Anti LINS1 pAb (ATL-HPA038578) Datasheet (External Link)
Vendor Page Anti LINS1 pAb (ATL-HPA038578) at Atlas Antibodies

Documents & Links for Anti LINS1 pAb (ATL-HPA038578)
Datasheet Anti LINS1 pAb (ATL-HPA038578) Datasheet (External Link)
Vendor Page Anti LINS1 pAb (ATL-HPA038578)