Anti LINGO3 pAb (ATL-HPA055932)

Atlas Antibodies

SKU:
ATL-HPA055932-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat and Ig domain containing 3
Gene Name: LINGO3
Alternative Gene Name: LERN2, LRRN6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051067: 94%, ENSRNOG00000032569: 94%
Entrez Gene ID: 645191
Uniprot ID: P0C6S8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR
Gene Sequence LWIVQRRKTLNFDGRLPACATPAEVRGDALRNLPDSVLFEYFVCRKPKIRERRLQRVTATAGEDVRFLCR
Gene ID - Mouse ENSMUSG00000051067
Gene ID - Rat ENSRNOG00000032569
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LINGO3 pAb (ATL-HPA055932)
Datasheet Anti LINGO3 pAb (ATL-HPA055932) Datasheet (External Link)
Vendor Page Anti LINGO3 pAb (ATL-HPA055932) at Atlas Antibodies

Documents & Links for Anti LINGO3 pAb (ATL-HPA055932)
Datasheet Anti LINGO3 pAb (ATL-HPA055932) Datasheet (External Link)
Vendor Page Anti LINGO3 pAb (ATL-HPA055932)