Anti LINC00493 pAb (ATL-HPA068733)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068733-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: LINC00493
Alternative Gene Name: LOC388789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074754: 38%, ENSRNOG00000036971: 37%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP |
Gene Sequence | SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP |
Gene ID - Mouse | ENSMUSG00000074754 |
Gene ID - Rat | ENSRNOG00000036971 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LINC00493 pAb (ATL-HPA068733) | |
Datasheet | Anti LINC00493 pAb (ATL-HPA068733) Datasheet (External Link) |
Vendor Page | Anti LINC00493 pAb (ATL-HPA068733) at Atlas Antibodies |
Documents & Links for Anti LINC00493 pAb (ATL-HPA068733) | |
Datasheet | Anti LINC00493 pAb (ATL-HPA068733) Datasheet (External Link) |
Vendor Page | Anti LINC00493 pAb (ATL-HPA068733) |