Anti LINC00493 pAb (ATL-HPA068733)

Atlas Antibodies

Catalog No.:
ATL-HPA068733-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: long intergenic non-protein coding RNA 493
Gene Name: LINC00493
Alternative Gene Name: LOC388789
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074754: 38%, ENSRNOG00000036971: 37%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP
Gene Sequence SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP
Gene ID - Mouse ENSMUSG00000074754
Gene ID - Rat ENSRNOG00000036971
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LINC00493 pAb (ATL-HPA068733)
Datasheet Anti LINC00493 pAb (ATL-HPA068733) Datasheet (External Link)
Vendor Page Anti LINC00493 pAb (ATL-HPA068733) at Atlas Antibodies

Documents & Links for Anti LINC00493 pAb (ATL-HPA068733)
Datasheet Anti LINC00493 pAb (ATL-HPA068733) Datasheet (External Link)
Vendor Page Anti LINC00493 pAb (ATL-HPA068733)