Anti LIN7A pAb (ATL-HPA071562)

Atlas Antibodies

Catalog No.: ATL-HPA071562-25

Protein Description: lin-7 homolog A, crumbs cell polarity complex component
Gene Name: LIN7A
Alternative Gene Name: LIN-7A, MALS-1, TIP-33, VELI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019906: 91%, ENSRNOG00000004527: 91%
Entrez Gene ID: 8825
Uniprot ID: O14910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV
• Gene Sequence: EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV
• Gene ID - Mouse: ENSMUSG00000019906
• Gene ID - Rat: ENSRNOG00000004527
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.