Anti LIN7A pAb (ATL-HPA071562)

Atlas Antibodies

Catalog No.:
ATL-HPA071562-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: lin-7 homolog A, crumbs cell polarity complex component
Gene Name: LIN7A
Alternative Gene Name: LIN-7A, MALS-1, TIP-33, VELI1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019906: 91%, ENSRNOG00000004527: 91%
Entrez Gene ID: 8825
Uniprot ID: O14910
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV
Gene Sequence EVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKVFSCV
Gene ID - Mouse ENSMUSG00000019906
Gene ID - Rat ENSRNOG00000004527
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LIN7A pAb (ATL-HPA071562)
Datasheet Anti LIN7A pAb (ATL-HPA071562) Datasheet (External Link)
Vendor Page Anti LIN7A pAb (ATL-HPA071562) at Atlas Antibodies

Documents & Links for Anti LIN7A pAb (ATL-HPA071562)
Datasheet Anti LIN7A pAb (ATL-HPA071562) Datasheet (External Link)
Vendor Page Anti LIN7A pAb (ATL-HPA071562)