Anti LIN28A pAb (ATL-HPA063074)

Atlas Antibodies

Catalog No.:
ATL-HPA063074-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lin-28 homolog A
Gene Name: LIN28A
Alternative Gene Name: CSDD1, FLJ12457, LIN-28, LIN28, ZCCHC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050966: 92%, ENSRNOG00000060320: 96%
Entrez Gene ID: 79727
Uniprot ID: Q9H9Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Gene Sequence KCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN
Gene ID - Mouse ENSMUSG00000050966
Gene ID - Rat ENSRNOG00000060320
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LIN28A pAb (ATL-HPA063074)
Datasheet Anti LIN28A pAb (ATL-HPA063074) Datasheet (External Link)
Vendor Page Anti LIN28A pAb (ATL-HPA063074) at Atlas Antibodies

Documents & Links for Anti LIN28A pAb (ATL-HPA063074)
Datasheet Anti LIN28A pAb (ATL-HPA063074) Datasheet (External Link)
Vendor Page Anti LIN28A pAb (ATL-HPA063074)