Anti LIMS1 pAb (ATL-HPA061230)

Atlas Antibodies

Catalog No.: ATL-HPA061230-25

Protein Description: LIM and senescent cell antigen-like domains 1
Gene Name: LIMS1
Alternative Gene Name: PINCH, PINCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027684: 31%, ENSRNOG00000037765: 95%
Entrez Gene ID: 3987
Uniprot ID: P48059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL
• Gene Sequence: MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL
• Gene ID - Mouse: ENSMUSG00000027684
• Gene ID - Rat: ENSRNOG00000037765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.