Anti LIMS1 pAb (ATL-HPA061230)

Atlas Antibodies

Catalog No.:
ATL-HPA061230-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: LIM and senescent cell antigen-like domains 1
Gene Name: LIMS1
Alternative Gene Name: PINCH, PINCH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027684: 31%, ENSRNOG00000037765: 95%
Entrez Gene ID: 3987
Uniprot ID: P48059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL
Gene Sequence MTALQLKELSHSGLYRRRRDRPDSLRVNGLPEEELSNMANAL
Gene ID - Mouse ENSMUSG00000027684
Gene ID - Rat ENSRNOG00000037765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LIMS1 pAb (ATL-HPA061230)
Datasheet Anti LIMS1 pAb (ATL-HPA061230) Datasheet (External Link)
Vendor Page Anti LIMS1 pAb (ATL-HPA061230) at Atlas Antibodies

Documents & Links for Anti LIMS1 pAb (ATL-HPA061230)
Datasheet Anti LIMS1 pAb (ATL-HPA061230) Datasheet (External Link)
Vendor Page Anti LIMS1 pAb (ATL-HPA061230)