Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063840-25
  • Immunohistochemical staining of human lung shows moderate cytoplasmic positivity in pneumocytes.
  • Immunofluorescent staining of human cell line HeLa shows localization to actin filaments.
  • Western blot analysis in human cell line HeLa and human cell line PC-3.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: LIM and calponin homology domains 1
Gene Name: LIMCH1
Alternative Gene Name: DKFZP686A01247, LIMCH1A, LMO7B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037736: 95%, ENSRNOG00000002318: 95%
Entrez Gene ID: 22998
Uniprot ID: Q9UPQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV
Gene Sequence LHEAYKNARSQEEAEGILQQYIERFTISEAVLERLEMPKILERSHSTEPNLSSFLNDPNPMKYLRQQSLPPPKFTATVETTIARASV
Gene ID - Mouse ENSMUSG00000037736
Gene ID - Rat ENSRNOG00000002318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation)
Datasheet Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LIMCH1 pAb (ATL-HPA063840 w/enhanced validation)