Anti LILRB5 pAb (ATL-HPA012069)

Atlas Antibodies

Catalog No.: ATL-HPA012069-25

Protein Description: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 5
Gene Name: LILRB5
Alternative Gene Name: CD85c, LIR-8, LIR8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062593: 55%, ENSRNOG00000046683: 56%
Entrez Gene ID: 10990
Uniprot ID: O75023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
• Gene Sequence: PKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATG
• Gene ID - Mouse: ENSMUSG00000062593
• Gene ID - Rat: ENSRNOG00000046683
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.