Anti LILRA4 pAb (ATL-HPA049418)

Atlas Antibodies

Catalog No.:
ATL-HPA049418-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
Gene Name: LILRA4
Alternative Gene Name: CD85g, ILT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062593: 52%, ENSRNOG00000058538: 52%
Entrez Gene ID: 23547
Uniprot ID: P59901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD
Gene Sequence DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD
Gene ID - Mouse ENSMUSG00000062593
Gene ID - Rat ENSRNOG00000058538
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LILRA4 pAb (ATL-HPA049418)
Datasheet Anti LILRA4 pAb (ATL-HPA049418) Datasheet (External Link)
Vendor Page Anti LILRA4 pAb (ATL-HPA049418) at Atlas Antibodies

Documents & Links for Anti LILRA4 pAb (ATL-HPA049418)
Datasheet Anti LILRA4 pAb (ATL-HPA049418) Datasheet (External Link)
Vendor Page Anti LILRA4 pAb (ATL-HPA049418)