Anti LILRA4 pAb (ATL-HPA049418)

Atlas Antibodies

Catalog No.: ATL-HPA049418-25

Protein Description: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
Gene Name: LILRA4
Alternative Gene Name: CD85g, ILT7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062593: 52%, ENSRNOG00000058538: 52%
Entrez Gene ID: 23547
Uniprot ID: P59901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD
• Gene Sequence: DHRLSWTLNSHQHNHGKFQALFPMGPLTFSNRGTFRCYGYENNTPYVWSEPSD
• Gene ID - Mouse: ENSMUSG00000062593
• Gene ID - Rat: ENSRNOG00000058538
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.