Anti LHX8 pAb (ATL-HPA071806)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071806-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LHX8
Alternative Gene Name: Lhx7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096225: 92%, ENSRNOG00000028348: 54%
Entrez Gene ID: 431707
Uniprot ID: Q68G74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT |
| Gene Sequence | LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT |
| Gene ID - Mouse | ENSMUSG00000096225 |
| Gene ID - Rat | ENSRNOG00000028348 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LHX8 pAb (ATL-HPA071806) | |
| Datasheet | Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link) |
| Vendor Page | Anti LHX8 pAb (ATL-HPA071806) at Atlas Antibodies |
| Documents & Links for Anti LHX8 pAb (ATL-HPA071806) | |
| Datasheet | Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link) |
| Vendor Page | Anti LHX8 pAb (ATL-HPA071806) |