Anti LHX8 pAb (ATL-HPA071806)

Atlas Antibodies

Catalog No.:
ATL-HPA071806-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LIM homeobox 8
Gene Name: LHX8
Alternative Gene Name: Lhx7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096225: 92%, ENSRNOG00000028348: 54%
Entrez Gene ID: 431707
Uniprot ID: Q68G74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT
Gene Sequence LEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQLPISHT
Gene ID - Mouse ENSMUSG00000096225
Gene ID - Rat ENSRNOG00000028348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LHX8 pAb (ATL-HPA071806)
Datasheet Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link)
Vendor Page Anti LHX8 pAb (ATL-HPA071806) at Atlas Antibodies

Documents & Links for Anti LHX8 pAb (ATL-HPA071806)
Datasheet Anti LHX8 pAb (ATL-HPA071806) Datasheet (External Link)
Vendor Page Anti LHX8 pAb (ATL-HPA071806)