Anti LHX4 pAb (ATL-HPA055705)

Atlas Antibodies

Catalog No.:
ATL-HPA055705-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: LIM homeobox 4
Gene Name: LHX4
Alternative Gene Name: Gsh4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026468: 98%, ENSRNOG00000003595: 98%
Entrez Gene ID: 89884
Uniprot ID: Q969G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSF
Gene Sequence QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSF
Gene ID - Mouse ENSMUSG00000026468
Gene ID - Rat ENSRNOG00000003595
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LHX4 pAb (ATL-HPA055705)
Datasheet Anti LHX4 pAb (ATL-HPA055705) Datasheet (External Link)
Vendor Page Anti LHX4 pAb (ATL-HPA055705) at Atlas Antibodies

Documents & Links for Anti LHX4 pAb (ATL-HPA055705)
Datasheet Anti LHX4 pAb (ATL-HPA055705) Datasheet (External Link)
Vendor Page Anti LHX4 pAb (ATL-HPA055705)