Anti LHX4 pAb (ATL-HPA055705)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055705-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LHX4
Alternative Gene Name: Gsh4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026468: 98%, ENSRNOG00000003595: 98%
Entrez Gene ID: 89884
Uniprot ID: Q969G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSF |
| Gene Sequence | QFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSF |
| Gene ID - Mouse | ENSMUSG00000026468 |
| Gene ID - Rat | ENSRNOG00000003595 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LHX4 pAb (ATL-HPA055705) | |
| Datasheet | Anti LHX4 pAb (ATL-HPA055705) Datasheet (External Link) |
| Vendor Page | Anti LHX4 pAb (ATL-HPA055705) at Atlas Antibodies |
| Documents & Links for Anti LHX4 pAb (ATL-HPA055705) | |
| Datasheet | Anti LHX4 pAb (ATL-HPA055705) Datasheet (External Link) |
| Vendor Page | Anti LHX4 pAb (ATL-HPA055705) |