Anti LHX1 pAb (ATL-HPA073521)

Atlas Antibodies

SKU:
ATL-HPA073521-25
  • Immunohistochemical staining of human kidney shows strong nuclear positivity in subset of cells in tubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: LIM homeobox 1
Gene Name: LHX1
Alternative Gene Name: LIM-1, LIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018698: 99%, ENSRNOG00000002812: 99%
Entrez Gene ID: 3975
Uniprot ID: P48742
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHL
Gene Sequence NGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHL
Gene ID - Mouse ENSMUSG00000018698
Gene ID - Rat ENSRNOG00000002812
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti LHX1 pAb (ATL-HPA073521)
Datasheet Anti LHX1 pAb (ATL-HPA073521) Datasheet (External Link)
Vendor Page Anti LHX1 pAb (ATL-HPA073521) at Atlas Antibodies

Documents & Links for Anti LHX1 pAb (ATL-HPA073521)
Datasheet Anti LHX1 pAb (ATL-HPA073521) Datasheet (External Link)
Vendor Page Anti LHX1 pAb (ATL-HPA073521)