Anti LFNG pAb (ATL-HPA069130)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069130-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: LFNG
Alternative Gene Name: SCDO3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029570: 88%, ENSRNOG00000001250: 92%
Entrez Gene ID: 3955
Uniprot ID: Q8NES3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAH |
| Gene Sequence | TKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNCSAAH |
| Gene ID - Mouse | ENSMUSG00000029570 |
| Gene ID - Rat | ENSRNOG00000001250 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LFNG pAb (ATL-HPA069130) | |
| Datasheet | Anti LFNG pAb (ATL-HPA069130) Datasheet (External Link) |
| Vendor Page | Anti LFNG pAb (ATL-HPA069130) at Atlas Antibodies |
| Documents & Links for Anti LFNG pAb (ATL-HPA069130) | |
| Datasheet | Anti LFNG pAb (ATL-HPA069130) Datasheet (External Link) |
| Vendor Page | Anti LFNG pAb (ATL-HPA069130) |