Anti LETMD1 pAb (ATL-HPA074361)

Atlas Antibodies

Catalog No.:
ATL-HPA074361-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LETM1 domain containing 1
Gene Name: LETMD1
Alternative Gene Name: HCCR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037353: 59%, ENSRNOG00000029855: 66%
Entrez Gene ID: 25875
Uniprot ID: Q6P1Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG
Gene Sequence FPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGLRWRLTDLCTKIQRG
Gene ID - Mouse ENSMUSG00000037353
Gene ID - Rat ENSRNOG00000029855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LETMD1 pAb (ATL-HPA074361)
Datasheet Anti LETMD1 pAb (ATL-HPA074361) Datasheet (External Link)
Vendor Page Anti LETMD1 pAb (ATL-HPA074361) at Atlas Antibodies

Documents & Links for Anti LETMD1 pAb (ATL-HPA074361)
Datasheet Anti LETMD1 pAb (ATL-HPA074361) Datasheet (External Link)
Vendor Page Anti LETMD1 pAb (ATL-HPA074361)