Anti LENG9 pAb (ATL-HPA053556)

Atlas Antibodies

Catalog No.:
ATL-HPA053556-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: leukocyte receptor cluster (LRC) member 9
Gene Name: LENG9
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043432: 38%, ENSRNOG00000018621: 40%
Entrez Gene ID: 94059
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDLVFGSGSAAGRGPTILDAPNTEGAHGAEGAEWTLAGTGQEAQAAPKRGSTRPLCTGHQEPGVEEPGELEAAQERALGTAADLGTLAPR
Gene Sequence TDLVFGSGSAAGRGPTILDAPNTEGAHGAEGAEWTLAGTGQEAQAAPKRGSTRPLCTGHQEPGVEEPGELEAAQERALGTAADLGTLAPR
Gene ID - Mouse ENSMUSG00000043432
Gene ID - Rat ENSRNOG00000018621
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LENG9 pAb (ATL-HPA053556)
Datasheet Anti LENG9 pAb (ATL-HPA053556) Datasheet (External Link)
Vendor Page Anti LENG9 pAb (ATL-HPA053556) at Atlas Antibodies

Documents & Links for Anti LENG9 pAb (ATL-HPA053556)
Datasheet Anti LENG9 pAb (ATL-HPA053556) Datasheet (External Link)
Vendor Page Anti LENG9 pAb (ATL-HPA053556)