Anti LENG8 pAb (ATL-HPA061571)

Atlas Antibodies

Catalog No.:
ATL-HPA061571-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: leukocyte receptor cluster (LRC) member 8
Gene Name: LENG8
Alternative Gene Name: KIAA1932, MGC40108, pp13842
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035545: 97%, ENSRNOG00000018642: 96%
Entrez Gene ID: 114823
Uniprot ID: Q96PV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPGNVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYCHAPCMSGYLVDKFADRE
Gene Sequence FTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPGNVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYCHAPCMSGYLVDKFADRE
Gene ID - Mouse ENSMUSG00000035545
Gene ID - Rat ENSRNOG00000018642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LENG8 pAb (ATL-HPA061571)
Datasheet Anti LENG8 pAb (ATL-HPA061571) Datasheet (External Link)
Vendor Page Anti LENG8 pAb (ATL-HPA061571) at Atlas Antibodies

Documents & Links for Anti LENG8 pAb (ATL-HPA061571)
Datasheet Anti LENG8 pAb (ATL-HPA061571) Datasheet (External Link)
Vendor Page Anti LENG8 pAb (ATL-HPA061571)