Anti LENG8 pAb (ATL-HPA061571)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061571-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LENG8
Alternative Gene Name: KIAA1932, MGC40108, pp13842
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035545: 97%, ENSRNOG00000018642: 96%
Entrez Gene ID: 114823
Uniprot ID: Q96PV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPGNVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYCHAPCMSGYLVDKFADRE |
| Gene Sequence | FTVEVYETHARIALEKGDHEEFNQCQTQLKSLYAENLPGNVGEFTAYRILYYIFTKNSGDITTELAYLTRELKADPCVAHALALRTAWALGNYHRFFRLYCHAPCMSGYLVDKFADRE |
| Gene ID - Mouse | ENSMUSG00000035545 |
| Gene ID - Rat | ENSRNOG00000018642 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LENG8 pAb (ATL-HPA061571) | |
| Datasheet | Anti LENG8 pAb (ATL-HPA061571) Datasheet (External Link) |
| Vendor Page | Anti LENG8 pAb (ATL-HPA061571) at Atlas Antibodies |
| Documents & Links for Anti LENG8 pAb (ATL-HPA061571) | |
| Datasheet | Anti LENG8 pAb (ATL-HPA061571) Datasheet (External Link) |
| Vendor Page | Anti LENG8 pAb (ATL-HPA061571) |