Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002087-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: lymphoid enhancer-binding factor 1
Gene Name: LEF1
Alternative Gene Name: TCF10, TCF1ALPHA, TCF7L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027985: 98%, ENSRNOG00000010121: 96%
Entrez Gene ID: 51176
Uniprot ID: Q9UJU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Gene Sequence SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY
Gene ID - Mouse ENSMUSG00000027985
Gene ID - Rat ENSRNOG00000010121
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation)
Datasheet Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation)
Datasheet Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation)
Citations for Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) – 3 Found
Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38.  PubMed
Pinto, Inês; Duque, Mafalda; Gonçalves, Joana; Akkapeddi, Padma; Oliveira, Mariana L; Cabrita, Rita; Yunes, J Andrés; Durum, Scott K; Barata, João T; Fragoso, Rita. NRARP displays either pro- or anti-tumoral roles in T-cell acute lymphoblastic leukemia depending on Notch and Wnt signaling. Oncogene. 2020;39(5):975-986.  PubMed
Chan, Siu Chiu; Hajarnis, Sachin S; Vrba, Sophia M; Patel, Vishal; Igarashi, Peter. Hepatocyte nuclear factor 1β suppresses canonical Wnt signaling through transcriptional repression of lymphoid enhancer-binding factor 1. The Journal Of Biological Chemistry. 2020;295(51):17560-17572.  PubMed