Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002087-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LEF1
Alternative Gene Name: TCF10, TCF1ALPHA, TCF7L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027985: 98%, ENSRNOG00000010121: 96%
Entrez Gene ID: 51176
Uniprot ID: Q9UJU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY |
| Gene Sequence | SDVNSKQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMSRFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLY |
| Gene ID - Mouse | ENSMUSG00000027985 |
| Gene ID - Rat | ENSRNOG00000010121 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) | |
| Datasheet | Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) | |
| Datasheet | Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) |
| Citations for Anti LEF1 pAb (ATL-HPA002087 w/enhanced validation) – 3 Found |
| Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38. PubMed |
| Pinto, Inês; Duque, Mafalda; Gonçalves, Joana; Akkapeddi, Padma; Oliveira, Mariana L; Cabrita, Rita; Yunes, J Andrés; Durum, Scott K; Barata, João T; Fragoso, Rita. NRARP displays either pro- or anti-tumoral roles in T-cell acute lymphoblastic leukemia depending on Notch and Wnt signaling. Oncogene. 2020;39(5):975-986. PubMed |
| Chan, Siu Chiu; Hajarnis, Sachin S; Vrba, Sophia M; Patel, Vishal; Igarashi, Peter. Hepatocyte nuclear factor 1β suppresses canonical Wnt signaling through transcriptional repression of lymphoid enhancer-binding factor 1. The Journal Of Biological Chemistry. 2020;295(51):17560-17572. PubMed |