Anti LECT2 pAb (ATL-HPA058246)

Atlas Antibodies

SKU: ATL-HPA058246-25

• 

Protein Description: leukocyte cell derived chemotaxin 2
Gene Name: LECT2
Alternative Gene Name: chm-II, chm2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021539: 83%, ENSRNOG00000012189: 80%
Entrez Gene ID: 3950
Uniprot ID: O14960
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ
• Gene Sequence: GPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILCSAGSTVYAPFTGMIVGQEKPYQ
• Gene ID - Mouse: ENSMUSG00000021539
• Gene ID - Rat: ENSRNOG00000012189
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.