Anti LDOC1 pAb (ATL-HPA061842)

Atlas Antibodies

SKU: ATL-HPA061842-25

• 

Protein Description: leucine zipper, down-regulated in cancer 1
Gene Name: LDOC1
Alternative Gene Name: BCUR1, Mar7, Mart7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057615: 72%, ENSRNOG00000003409: 81%
Entrez Gene ID: 23641
Uniprot ID: O95751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD
• Gene Sequence: ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD
• Gene ID - Mouse: ENSMUSG00000057615
• Gene ID - Rat: ENSRNOG00000003409
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.