Anti LDOC1 pAb (ATL-HPA061842)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061842-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LDOC1
Alternative Gene Name: BCUR1, Mar7, Mart7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057615: 72%, ENSRNOG00000003409: 81%
Entrez Gene ID: 23641
Uniprot ID: O95751
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD |
Gene Sequence | ISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDD |
Gene ID - Mouse | ENSMUSG00000057615 |
Gene ID - Rat | ENSRNOG00000003409 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LDOC1 pAb (ATL-HPA061842) | |
Datasheet | Anti LDOC1 pAb (ATL-HPA061842) Datasheet (External Link) |
Vendor Page | Anti LDOC1 pAb (ATL-HPA061842) at Atlas Antibodies |
Documents & Links for Anti LDOC1 pAb (ATL-HPA061842) | |
Datasheet | Anti LDOC1 pAb (ATL-HPA061842) Datasheet (External Link) |
Vendor Page | Anti LDOC1 pAb (ATL-HPA061842) |