Anti LDLRAP1 pAb (ATL-HPA050358)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA050358-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $303.00
    
         
                            Gene Name: LDLRAP1
Alternative Gene Name: ARH, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037295: 87%, ENSRNOG00000000151: 86%
Entrez Gene ID: 26119
Uniprot ID: Q5SW96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL | 
| Gene Sequence | MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL | 
| Gene ID - Mouse | ENSMUSG00000037295 | 
| Gene ID - Rat | ENSRNOG00000000151 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358) | |
| Datasheet | Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link) | 
| Vendor Page | Anti LDLRAP1 pAb (ATL-HPA050358) at Atlas Antibodies | 
| Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358) | |
| Datasheet | Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link) | 
| Vendor Page | Anti LDLRAP1 pAb (ATL-HPA050358) |