Anti LDLRAP1 pAb (ATL-HPA050358)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050358-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LDLRAP1
Alternative Gene Name: ARH, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037295: 87%, ENSRNOG00000000151: 86%
Entrez Gene ID: 26119
Uniprot ID: Q5SW96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL |
| Gene Sequence | MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL |
| Gene ID - Mouse | ENSMUSG00000037295 |
| Gene ID - Rat | ENSRNOG00000000151 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358) | |
| Datasheet | Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link) |
| Vendor Page | Anti LDLRAP1 pAb (ATL-HPA050358) at Atlas Antibodies |
| Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358) | |
| Datasheet | Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link) |
| Vendor Page | Anti LDLRAP1 pAb (ATL-HPA050358) |