Anti LDLRAP1 pAb (ATL-HPA050358)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050358-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LDLRAP1
Alternative Gene Name: ARH, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037295: 87%, ENSRNOG00000000151: 86%
Entrez Gene ID: 26119
Uniprot ID: Q5SW96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL |
Gene Sequence | MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL |
Gene ID - Mouse | ENSMUSG00000037295 |
Gene ID - Rat | ENSRNOG00000000151 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358) | |
Datasheet | Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link) |
Vendor Page | Anti LDLRAP1 pAb (ATL-HPA050358) at Atlas Antibodies |
Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358) | |
Datasheet | Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link) |
Vendor Page | Anti LDLRAP1 pAb (ATL-HPA050358) |