Anti LDLRAP1 pAb (ATL-HPA050358)

Atlas Antibodies

Catalog No.:
ATL-HPA050358-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: low density lipoprotein receptor adaptor protein 1
Gene Name: LDLRAP1
Alternative Gene Name: ARH, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037295: 87%, ENSRNOG00000000151: 86%
Entrez Gene ID: 26119
Uniprot ID: Q5SW96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL
Gene Sequence MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL
Gene ID - Mouse ENSMUSG00000037295
Gene ID - Rat ENSRNOG00000000151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358)
Datasheet Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link)
Vendor Page Anti LDLRAP1 pAb (ATL-HPA050358) at Atlas Antibodies

Documents & Links for Anti LDLRAP1 pAb (ATL-HPA050358)
Datasheet Anti LDLRAP1 pAb (ATL-HPA050358) Datasheet (External Link)
Vendor Page Anti LDLRAP1 pAb (ATL-HPA050358)