Anti LDLRAP1 pAb (ATL-HPA050358)

Atlas Antibodies

Catalog No.: ATL-HPA050358-25

Protein Description: low density lipoprotein receptor adaptor protein 1
Gene Name: LDLRAP1
Alternative Gene Name: ARH, ARH2, DKFZp586D0624, FHCB1, FHCB2, MGC34705
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037295: 87%, ENSRNOG00000000151: 86%
Entrez Gene ID: 26119
Uniprot ID: Q5SW96
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL
• Gene Sequence: MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL
• Gene ID - Mouse: ENSMUSG00000037295
• Gene ID - Rat: ENSRNOG00000000151
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.