Anti LDHD pAb (ATL-HPA066148)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066148-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LDHD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031958: 87%, ENSRNOG00000019036: 89%
Entrez Gene ID: 197257
Uniprot ID: Q86WU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWA |
Gene Sequence | CAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWA |
Gene ID - Mouse | ENSMUSG00000031958 |
Gene ID - Rat | ENSRNOG00000019036 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LDHD pAb (ATL-HPA066148) | |
Datasheet | Anti LDHD pAb (ATL-HPA066148) Datasheet (External Link) |
Vendor Page | Anti LDHD pAb (ATL-HPA066148) at Atlas Antibodies |
Documents & Links for Anti LDHD pAb (ATL-HPA066148) | |
Datasheet | Anti LDHD pAb (ATL-HPA066148) Datasheet (External Link) |
Vendor Page | Anti LDHD pAb (ATL-HPA066148) |