Anti LDHD pAb (ATL-HPA066148)

Atlas Antibodies

Catalog No.:
ATL-HPA066148-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lactate dehydrogenase D
Gene Name: LDHD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031958: 87%, ENSRNOG00000019036: 89%
Entrez Gene ID: 197257
Uniprot ID: Q86WU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWA
Gene Sequence CAFPSVQAAVDSTVHILQAAVPVARIEFLDEVMMDACNRYSKLNCLVAPTLFLEFHGSQQALEEQLQRTEEIVQQNGASDFSWA
Gene ID - Mouse ENSMUSG00000031958
Gene ID - Rat ENSRNOG00000019036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LDHD pAb (ATL-HPA066148)
Datasheet Anti LDHD pAb (ATL-HPA066148) Datasheet (External Link)
Vendor Page Anti LDHD pAb (ATL-HPA066148) at Atlas Antibodies

Documents & Links for Anti LDHD pAb (ATL-HPA066148)
Datasheet Anti LDHD pAb (ATL-HPA066148) Datasheet (External Link)
Vendor Page Anti LDHD pAb (ATL-HPA066148)