Anti LCORL pAb (ATL-HPA028795)

Atlas Antibodies

Catalog No.: ATL-HPA028795-25

Protein Description: ligand dependent nuclear receptor corepressor-like
Gene Name: LCORL
Alternative Gene Name: FLJ30696, MLR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015882: 94%, ENSRNOG00000032258: 27%
Entrez Gene ID: 254251
Uniprot ID: Q8N3X6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVSSVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSV
• Gene Sequence: TYLHQLTLQKMVTQFKEKNESLQYETSNPTVQLKIPQLRVSSVSKSQPDGSGLLDVMYQVSKTSSVLEGSALQKLKNILPKQNKIECSGPVTHSSV
• Gene ID - Mouse: ENSMUSG00000015882
• Gene ID - Rat: ENSRNOG00000032258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.