Anti LCOR pAb (ATL-HPA077000)

Atlas Antibodies

Catalog No.:
ATL-HPA077000-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ligand dependent nuclear receptor corepressor
Gene Name: LCOR
Alternative Gene Name: FLJ38026, KIAA1795, MLR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025019: 99%, ENSRNOG00000042679: 99%
Entrez Gene ID: 84458
Uniprot ID: Q96JN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQD
Gene Sequence QQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQD
Gene ID - Mouse ENSMUSG00000025019
Gene ID - Rat ENSRNOG00000042679
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LCOR pAb (ATL-HPA077000)
Datasheet Anti LCOR pAb (ATL-HPA077000) Datasheet (External Link)
Vendor Page Anti LCOR pAb (ATL-HPA077000) at Atlas Antibodies

Documents & Links for Anti LCOR pAb (ATL-HPA077000)
Datasheet Anti LCOR pAb (ATL-HPA077000) Datasheet (External Link)
Vendor Page Anti LCOR pAb (ATL-HPA077000)