Anti LCOR pAb (ATL-HPA031428)

Atlas Antibodies

Catalog No.: ATL-HPA031428-25

Protein Description: ligand dependent nuclear receptor corepressor
Gene Name: LCOR
Alternative Gene Name: FLJ38026, KIAA1795, MLR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025019: 94%, ENSRNOG00000042679: 93%
Entrez Gene ID: 84458
Uniprot ID: Q96JN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE
• Gene Sequence: HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE
• Gene ID - Mouse: ENSMUSG00000025019
• Gene ID - Rat: ENSRNOG00000042679
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.